PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_004206-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 372aa    MW: 41829.8 Da    PI: 6.8364
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_004206-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd++l+d+++++G+g+W+  +++ g+ R++k+c++rw +yl
  AHYPO_004206-RA 14 KGPWLPEEDQKLIDYIQKYGPGNWRNLPKKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding551.9e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++ +lG++ W++Ia++++ gRt++++k++w+++
  AHYPO_004206-RA  67 RGRFSFEEEEAIIQLHSMLGNK-WSAIAAKLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.008965IPR017930Myb domain
SuperFamilySSF466891.5E-3011108IPR009057Homeodomain-like
SMARTSM007173.6E-141363IPR001005SANT/Myb domain
PfamPF002499.5E-161461IPR001005SANT/Myb domain
CDDcd001672.39E-121661No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.95466116IPR017930Myb domain
SMARTSM007178.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.0E-1567111IPR001005SANT/Myb domain
CDDcd001671.59E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGRAPCCDKD GLKKGPWLPE EDQKLIDYIQ KYGPGNWRNL PKKAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEEAIIQ LHSMLGNKWS AIAAKLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHTRRL DFLDLPSILN NHYSDHLQNY SSNHQLNLLK LLGNLQSLVN PNLLGLASLL  180
STTQAQAQAQ TQAQNFDILQ NLQSNQLFST NSSPIMQNPN QNCSQMVNNS NTTTFGNTQV  240
VKSSLDTYPT KFTNFDSENN IKNCSDCDNH LAINNACMLN NEVNSECAQN SDNYQVILDS  300
LLDTLGLNSA NNDVELKMPS LLSTPCSSQQ TPTPPLSASN SAYNQPNSST TTSSEDEIDS  360
YCKNLMNFDV PF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-32121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-32121162105C-Myb DNA-Binding Domain
1msf_C8e-32121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010686262.11e-135PREDICTED: transcription factor MYB39-like
TrEMBLA0A0J8BWT21e-135A0A0J8BWT2_BETVU; Uncharacterized protein
STRINGSolyc02g079280.2.11e-110(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.13e-89MYB-like 102